KRT8 ORF clone

Services

Gene ID: 3856

Synonym(s): CARD2, CK-8, CK8, CYK8, K2C8, K8, KO

Description: This gene is a member of the type II keratin family clustered on the long arm of chromosome 12. Type I and type II keratins heteropolymerize to form intermediate-sized filaments in the cytoplasm of epithelial cells. The product of this gene typically dimerizes with keratin 18 to form an intermediate filament in simple single-layered epithelial cells. This protein plays a role in maintaining cellular structural integrity and also functions in signal transduction and cellular differentiation. Mutations in this gene cause cryptogenic cirrhosis. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jan 2012].

This ORF sequence encodes a protein that is exactly the same as the proteins of NM_001256293, NM_002273. The protein has 47 functional sites and/or regions.

Product Details

Clone Vector	pLV-CMV-MCS-RFP-PGK-PuroR Lentiviral Vector
Species	Human
Promotor for Target Gene	CMV
Target Gene Name	KRT8
Target Gene Position	Inserted between PacI and AscI
ORF Length	1449
Protein Length	483
Native Stop Codon	False
ORF Sequence	atgtccatcagggtgacccagaagtcctacaaggtgtccacctctggcccccgggccttcagcagccgctcctacacgagtgggcccggttcccgcatcagctcctcgagcttctcccgagtgggcagcagcaactttcgcggtggcctgggcggcggctatggtggggccagcggcatgggaggcatcaccgcagttacggtcaaccagagcctgctgagcccccttgtcctggaggtggaccccaacatccaggccgtgcgcacccaggagaaggagcagatcaagaccctcaacaacaagtttgcctccttcatagacaaggtacggttcctggagcagcagaacaagatgctggagaccaagtggagcctcctgcagcagcagaagacggctcgaagcaacatggacaacatgttcgagagctacatcaacaaccttaggcggcagctggagactctgggccaggagaagctgaagctggaggcggagcttggcaacatgcaggggctggtggaggacttcaagaacaagtatgaggatgagatcaataagcgtacagagatggagaacgaatttgtcctcatcaagaaggatgtggatgaagcttacatgaacaaggtagagctggagtctcgcctggaagggctgaccgacgagatcaacttcctcaggcagctatatgaagaggagatccgggagctgcagtcccagatctcggacacatctgtggtgctgtccatggacaacagccgctccctggacatggacagcatcattgctgaggtcaaggcacagtacgaggatattgccaaccgcagccgggctgaggctgagagcatgtaccagatcaagtatgaggagctgcagagcctggctgggaagcacggggatgacctgcggcgcacaaagactgagatctctgagatgaaccggaacatcagccggctccaggctgagattgagggcctcaaaggccagagggcttccctggaggccgccattgcagatgccgagcagcgtggagagctggccattaaggatgccaacgccaagttgtccgagctggaggccgccctgcagcgggccaagcaggacatggcgcggcagctgcgtgagtaccaggagctgatgaacgtcaagctggccctggacatcgagatcgccacctacaggaagctgctggagggcgaggagagccggctggagtctgggatgcagaacatgagtattcatacgaagaccaccagcggctatgcaggtggtctgagctcggcctatgggggcctcacaagccccggcctcagctacagcctgggctccagctttggctctggcgcgggctccagctccttcagccgcaccagctcctccagggccgtggttgtgaagaagatcgagacacgtgatgggaagctggtgtctgagtcctctgacgtcctgcccaag
Protein Sequence	MSIRVTQKSYKVSTSGPRAFSSRSYTSGPGSRISSSSFSRVGSSNFRGGLGGGYGGASGMGGITAVTVNQSLLSPLVLEVDPNIQAVRTQEKEQIKTLNNKFASFIDKVRFLEQQNKMLETKWSLLQQQKTARSNMDNMFESYINNLRRQLETLGQEKLKLEAELGNMQGLVEDFKNKYEDEINKRTEMENEFVLIKKDVDEAYMNKVELESRLEGLTDEINFLRQLYEEEIRELQSQISDTSVVLSMDNSRSLDMDSIIAEVKAQYEDIANRSRAEAESMYQIKYEELQSLAGKHGDDLRRTKTEISEMNRNISRLQAEIEGLKGQRASLEAAIADAEQRGELAIKDANAKLSELEAALQRAKQDMARQLREYQELMNVKLALDIEIATYRKLLEGEESRLESGMQNMSIHTKTTSGYAGGLSSAYGGLTSPGLSYSLGSSFGSGAGSSSFSRTSSSRAVVVKKIETRDGKLVSESSDVLPK
Functional Site/Region	Region at 1-90, Head, seq too large to show; Region at 1-41, Disordered., seq=MSIRVTQKSYKVSTSGPRAFSSRSYTSGPGSRISSSSFSRV; Site at 9-9, phosphorylation, seq=S; Site at 13-13, phosphorylation, seq=S; Site at 15-15, phosphorylation, seq=S; Site at 21-21, phosphorylation, seq=S; Site at 22-22, phosphorylation, seq=S; Site at 23-23, methylation, seq=R; Site at 24-24, phosphorylation, seq=S; Site at 26-26, phosphorylation, seq=T; Site at 27-27, phosphorylation, seq=S; Site at 31-31, phosphorylation, seq=S; Site at 32-32, methylation, seq=R; Site at 34-34, phosphorylation, seq=S; Site at 37-37, phosphorylation, seq=S; Site at 39-39, phosphorylation, seq=S; Site at 40-40, methylation, seq=R; Site at 43-43, phosphorylation, seq=S; Site at 44-44, phosphorylation, seq=S; Site at 47-47, methylation, seq=R; Site at 74-74, phosphorylation, seq=S; Region at 91-126, Coil 1A, seq=EKEQIKTLNNKFASFIDKVRFLEQQNKMLETKWSLL; Region at 127-143, Linker 1, seq=QQQKTARSNMDNMFESY; Region at 144-235, Coil 1B, seq too large to show; Site at 207-207, acetylation, seq=K; Site at 228-228, phosphorylation, seq=Y; Region at 236-259, Linker 12, seq=QSQISDTSVVLSMDNSRSLDMDSI; Site at 253-253, phosphorylation, seq=S; Site at 258-258, phosphorylation, seq=S; Region at 260-398, Coil 2, seq too large to show; Region at 261-382, Necessary for interaction with PNN., seq too large to show; Site at 274-274, phosphorylation, seq=S; Site at 291-291, phosphorylation, seq=S; Site at 295-295, acetylation, seq=K; Site at 325-325, acetylation, seq=K; Site at 330-330, phosphorylation, seq=S; Site at 342-342, other, seq=G; Region at 399-483, Tail, seq too large to show; Site at 400-400, phosphorylation, seq=S; Site at 404-404, phosphorylation, seq=S; Site at 410-410, phosphorylation, seq=S; Site at 417-417, phosphorylation, seq=S; Site at 424-424, phosphorylation, seq=S; Site at 432-432, phosphorylation, seq=S; Site at 475-475, phosphorylation, seq=S; Site at 477-477, phosphorylation, seq=S; Site at 478-478, phosphorylation, seq=S;

User Instructions | pLV-CMV-ORF-RFP-PGK-PuroR Vector Map | Materials Safety Data Sheet

Catalog Number	Product	Size	Price	Qty
ET-107667-LVR-50	KRT8 Lentivirus Particles (PuroR, RFP)	2x25 ul per vial, 1x10^8 TU/ml	Price: $700.00	Quantity
ET-107667-LVR-200	KRT8 Lentivirus Particles (PuroR, RFP)	8x25 ul per vial, 1x10^8 TU/ml	Price: $1,200.00	Quantity
ET-107667-LVR-pd	KRT8 Lentiviral Transfer Vector (Puro, RFP): Glycerol Stock	1 vial	Price: $1,200.00	Quantity

Products

Services

KRT8 Full-Length ORF: Human Gene RFP Lentivirus

Shopping Cart: 0 Items

Your Wishlist: 0 Items