ARPC5L ORF clone

Products

Services

Gene ID: 81873

Synonym(s): ARC16-2

Description: actin related protein 2/3 complex subunit 5 like

This ORF sequence encodes a protein that is exactly the same as the protein of NM_030978. The protein has a functional site and/or region.

Product Details

Clone Vector	pCT-AAV-CMV-MCS vector
Species	Human
Promotor for Target Gene	CMV
Target Gene Name	ARPC5L
Target Gene Position	Inserted between PacI and AscI
ORF Length	462
Protein Length	153
Native Stop Codon	True
ORF Sequence	atggcccggaacacgctgtcctcgcgcttccgccgggtggacatcgacgaatttgacgagaacaaatttgtggacgagcaggaggaggcggcggcggcggcggcggagccaggcccggacccgagcgaggtggacgggctcctgcggcaaggggacatgcttcgggcattccatgcagccttgcggaactctcccgtcaacaccaagaatcaagctgtgaaggagcgagcccagggcgtggtgctgaaagtgctcacaaacttcaagagcagtgagattgagcaggctgtgcagtcactggacagaaacggcgttgacttgttaatgaagtacatttataaaggctttgagaagcccacagaaaatagcagcgcagtgttactccagtggcacgaaaaggccttagcagtaggaggactaggctccattataagagttcttacagcaagaaagactgtttaa
Protein Sequence	MARNTLSSRFRRVDIDEFDENKFVDEQEEAAAAAAEPGPDPSEVDGLLRQGDMLRAFHAALRNSPVNTKNQAVKERAQGVVLKVLTNFKSSEIEQAVQSLDRNGVDLLMKYIYKGFEKPTENSSAVLLQWHEKALAVGGLGSIIRVLTARKTV
Functional Site/Region	Site at 64-64, phosphorylation, seq=S;

Serotype	Targeting Tissues
1	Central Nervous System, Heart, Retinal Pigment Epithelium, Skeletal Muscle
2	Central Nervous System, Kidney, Photoreceptor Cells, Retinal Pigment Epithelium
5	Central Nervous System, Lung, Photoreceptor Cells, Retinal Pigment Epithelium
7	Liver, Skeletal Muscle
8	Central Nervous System, Heart, Liver, Pancreas, Photoreceptor Cells, Retinal Pigment Epithelium
9	Central Nervous System, Heart, Liver, Lung, Skeletal Muscle
RH10	Central Nervous System, Liver, Skeletal Muscle, Lung

User Instructions | pCT-AAV-CMV-ORF Vector Map | Materials Safety Data Sheet

Catalog Number	Product	Size	Price	Qty
ET-100001-AAV-1-50	ARPC5L rAAV Virus Particles (Serotype 1)	2x25 ul per vial, 1x10^12 gc/ml	Price: $700.00	Quantity
ET-100001-AAV-1-200	ARPC5L rAAV Virus Particles (Serotype 1)	8x25 ul per vial, 1x10^12 gc/ml	Price: $1,200.00	Quantity
ET-100001-AAV-2-50	ARPC5L rAAV Virus Particles (Serotype 2)	2x25 ul per vial, 1x10^12 gc/ml	Price: $700.00	Quantity
ET-100001-AAV-2-200	ARPC5L rAAV Virus Particles (Serotype 2)	8x25 ul per vial, 1x10^12 gc/ml	Price: $1,200.00	Quantity
ET-100001-AAV-5-50	ARPC5L rAAV Virus Particles (Serotype 5)	2x25 ul per vial, 1x10^12 gc/ml	Price: $700.00	Quantity
ET-100001-AAV-5-200	ARPC5L rAAV Virus Particles (Serotype 5)	8x25 ul per vial, 1x10^12 gc/ml	Price: $1,200.00	Quantity
ET-100001-AAV-7-50	ARPC5L rAAV Virus Particles (Serotype 7)	2x25 ul per vial, 1x10^12 gc/ml	Price: $700.00	Quantity
ET-100001-AAV-7-200	ARPC5L rAAV Virus Particles (Serotype 7)	8x25 ul per vial, 1x10^12 gc/ml	Price: $1,200.00	Quantity
ET-100001-AAV-8-50	ARPC5L rAAV Virus Particles (Serotype 8)	2x25 ul per vial, 1x10^12 gc/ml	Price: $700.00	Quantity
ET-100001-AAV-8-200	ARPC5L rAAV Virus Particles (Serotype 8)	8x25 ul per vial, 1x10^12 gc/ml	Price: $1,200.00	Quantity
ET-100001-AAV-9-50	ARPC5L rAAV Virus Particles (Serotype 9)	2x25 ul per vial, 1x10^12 gc/ml	Price: $700.00	Quantity
ET-100001-AAV-9-200	ARPC5L rAAV Virus Particles (Serotype 9)	8x25 ul per vial, 1x10^12 gc/ml	Price: $1,200.00	Quantity
ET-100001-AAV-RH10-50	ARPC5L rAAV Virus Particles (Serotype RH10)	2x25 ul per vial, 1x10^12 gc/ml	Price: $700.00	Quantity
ET-100001-AAV-RH10-200	ARPC5L rAAV Virus Particles (Serotype RH10)	8x25 ul per vial, 1x10^12 gc/ml	Price: $1,200.00	Quantity
ET-100001-AAV-pd	ARPC5L pAAV-CMV-ORF TRANSFER VECTOR (Plasmid), Glycerol Stock	1 vial	Price: $1,200.00	Quantity

Loading...